PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn345561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 271aa    MW: 31013.3 Da    PI: 4.7573
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn345561genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260102.34.5e-3241022100
      DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 Ca+C+++rr+C+++Cv+a +fp +++++f+ v+++FG+sn +k+lk+l+ +++++++++l++eAea+ +dP+ G +g++ +l++q+  lk+e+++lkee
  Achn345561   4 CASCAHQRRTCPEGCVMALHFPRTRTQEFQLVNRVFGVSNAIKILKDLNFSQQKETVEALIWEAEAWEQDPICGPLGLYERLEEQILMLKEEIQMLKEE 102
                 **********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.8842103IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-294100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MANCASCAHQ RRTCPEGCVM ALHFPRTRTQ EFQLVNRVFG VSNAIKILKD LNFSQQKETV  60
EALIWEAEAW EQDPICGPLG LYERLEEQIL MLKEEIQMLK EEIQMPGEQN PVIQERGFDL  120
ERDNGHIYVQ QQNVANPSFV QDLERERNHG VQGFHHQEQE RGNNSGRQTI LQQEEVDRES  180
SGGGGIRTFQ HHSVQELERE SDERERASES YQGPERGTHR NNNIPGSSVC EFNVMSFNFQ  240
IIDGLHGYVQ DADVARTGCV QDSQNPIFFR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.23e-22LOB domain-containing protein 10